PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.0562s0025.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MIKC_MADS
Protein Properties Length: 233aa    MW: 27369.9 Da    PI: 8.939
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.0562s0025.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF94.26e-30959151
                         S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
               SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                         krien++nrqvt+skRrng++KKA+EL vLCda+v++i+fss++kl+ey+s
  Cagra.0562s0025.1.p  9 KRIENQTNRQVTYSKRRNGLFKKAHELTVLCDARVSIIMFSSSNKLHEYIS 59
                         79***********************************************86 PP

2K-box78.31.9e-2671169199
                K-box   1 yqkssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqee 90 
                          yq+ s+++++++++e++q+  +kL + ++nL+++++++lGe+Le+L++ eL++Le+++e+  k +R++K + l +qie+++kk+k++q++
  Cagra.0562s0025.1.p  71 YQSISDVDVWSTQYERMQETKRKLLETNRNLRTQIKQRLGECLEELDYHELRRLEDEMENTFKLVRERKIKSLGNQIETTKKKNKSQQDI 160
                          78899999********************************************************************************** PP

                K-box  91 nkaLrkkle 99 
                          +k+L ++le
  Cagra.0562s0025.1.p 161 QKNLIHELE 169
                          ****99875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006632.142161IPR002100Transcription factor, MADS-box
SMARTSM004321.0E-40160IPR002100Transcription factor, MADS-box
CDDcd002656.21E-40280No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004046.1E-29323IPR002100Transcription factor, MADS-box
SuperFamilySSF554554.06E-36394IPR002100Transcription factor, MADS-box
PfamPF003192.4E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004046.1E-292338IPR002100Transcription factor, MADS-box
PRINTSPR004046.1E-293859IPR002100Transcription factor, MADS-box
PfamPF014862.5E-1482168IPR002487Transcription factor, K-box
PROSITE profilePS5129713.60784174IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010093Biological Processspecification of floral organ identity
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 233 aa     Download sequence    Send to blast
MARGKIQIKR IENQTNRQVT YSKRRNGLFK KAHELTVLCD ARVSIIMFSS SNKLHEYISP  60
NTTTKEIVDL YQSISDVDVW STQYERMQET KRKLLETNRN LRTQIKQRLG ECLEELDYHE  120
LRRLEDEMEN TFKLVRERKI KSLGNQIETT KKKNKSQQDI QKNLIHELEL RAEDPHYGLV  180
DNGGDYDSVL GYQIEGSRAY ALRFHQNHHH HYPNHALHAP SASDIITFHL LE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P5e-18161161Myocyte-specific enhancer factor 2B
1tqe_Q5e-18161161Myocyte-specific enhancer factor 2B
1tqe_R5e-18161161Myocyte-specific enhancer factor 2B
1tqe_S5e-18161161Myocyte-specific enhancer factor 2B
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00077ChIP-seqTransfer from AT3G54340Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU5517640.0EU551764.1 Capsella bursa-pastoris APETALA3-like protein (AP3a) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006292594.11e-173hypothetical protein CARUB_v10018833mg
SwissprotP356321e-170AP3_ARATH; Floral homeotic protein APETALA 3
TrEMBLR0FRZ91e-173R0FRZ9_9BRAS; Uncharacterized protein
STRINGfgenesh2_kg.5__1825__AT3G54340.11e-169(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM52612750
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54340.11e-154MIKC_MADS family protein